SCOPe 2.08: Domain d2xcpb2: 2xcp B:241-342

Lineage for d2xcpb2 (2xcp B:241-342)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
   beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology

4. Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families)

5. Family d.240.1.0: automated matches [231323] (1 protein)
   not a true family

6. Protein automated matches [231324] (5 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:273057] [231327] (33 PDB entries)

8. Domain d2xcpb2: 2xcp B:241-342 [244484]
   Other proteins in same PDB: d2xcpa1, d2xcpb1, d2xcpb3
   automated match to d2v4ra2
   protein/DNA complex; protein/RNA complex; complexed with dcp, mg

Details for d2xcpb2

PDB Entry: 2xcp, 2.6 Å

PDB Description: ternary complex of sulfolobus solfataricus dpo4 dna polymerase, 7,8- dihydro-8-oxodeoxyguanine modified dna and dctp - magnesium form

PDB Compounds: (B:) DNA polymerase IV

SCOPe Domain Sequences for d2xcpb2:

Sequence; same for both SEQRES and ATOM records:

>d2xcpb2 d.240.1.0 (B:241-342) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
tfphgisketaysesvkllqkileederkirrigvrfskfie

Timeline for d2xcpb2:

• d2xcpb2 first appeared in SCOPe 2.04
  
• d2xcpb2 appears in SCOPe 2.07