Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
Protein automated matches [190085] (59 species) not a true protein |
Species Escherichia coli [TaxId:562] [255679] (2 PDB entries) |
Domain d2x86s_: 2x86 S: [244471] automated match to d1eq2a_ complexed with adp, bma, nap |
PDB Entry: 2x86 (more details), 2.8 Å
SCOPe Domain Sequences for d2x86s_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x86s_ c.2.1.2 (S:) automated matches {Escherichia coli [TaxId: 562]} miivtggagfigsnivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqi mageefgdveaifhegacssttewdgkymmdnnyqyskellhyclereipflyassaaty ggrtsdfiesreyekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgs masvafhlntqlnngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgra esfqavadatlayhkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvt eymawln
Timeline for d2x86s_: