Lineage for d1ndoc1 (1ndo C:1-154)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 109277Fold b.33: ISP domain [50021] (1 superfamily)
  4. 109278Superfamily b.33.1: ISP domain [50022] (2 families) (S)
  5. 109307Family b.33.1.2: Naphthalene 1,2-dioxygenase alpha subunit, N-domain [50033] (1 protein)
  6. 109308Protein Naphthalene 1,2-dioxygenase alpha subunit, N-domain [50034] (1 species)
  7. 109309Species Pseudomonas putida [TaxId:303] [50035] (2 PDB entries)
  8. 109312Domain d1ndoc1: 1ndo C:1-154 [24445]
    Other proteins in same PDB: d1ndoa2, d1ndob_, d1ndoc2, d1ndod_, d1ndoe2, d1ndof_

Details for d1ndoc1

PDB Entry: 1ndo (more details), 2.25 Å

PDB Description: napthalene 1,2-dioxygenase

SCOP Domain Sequences for d1ndoc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ndoc1 b.33.1.2 (C:1-154) Naphthalene 1,2-dioxygenase alpha subunit, N-domain {Pseudomonas putida}
mnynnkilvsesglsqkhlihgdeelfqhelktifarnwlflthdslipapgdyvtakmg
idevivsrqndgsiraflnvcrhrgktlvsveagnakgfvcsyhgwgfgsngelqsvpfe
kdlygeslnkkclglkevarvesfhgfiygcfdq

SCOP Domain Coordinates for d1ndoc1:

Click to download the PDB-style file with coordinates for d1ndoc1.
(The format of our PDB-style files is described here.)

Timeline for d1ndoc1: