Lineage for d2x6aa2 (2x6a A:139-294)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2375023Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2375864Family b.1.18.16: Cytoplasmic domain of inward rectifier potassium channel [81966] (4 proteins)
  6. 2375882Protein automated matches [190782] (2 species)
    not a true protein
  7. 2375883Species Magnetospirillum magnetotacticum [TaxId:188] [229112] (5 PDB entries)
  8. 2375887Domain d2x6aa2: 2x6a A:139-294 [244440]
    Other proteins in same PDB: d2x6aa1, d2x6aa3
    automated match to d2wlka2
    complexed with k, pc

Details for d2x6aa2

PDB Entry: 2x6a (more details), 3.1 Å

PDB Description: potassium channel from magnetospirillum magnetotacticum
PDB Compounds: (A:) ATP-sensitive inward rectifier potassium channel 10

SCOPe Domain Sequences for d2x6aa2:

Sequence, based on SEQRES records: (download)

>d2x6aa2 b.1.18.16 (A:139-294) automated matches {Magnetospirillum magnetotacticum [TaxId: 188]}
tagvlfssrmvisdfegkptlmmrlanlrieaiieadvhlvlvrsevsqegmvfrrfhdl
tltrsrspifslswtvmhpidhhspiygetdetlrnshseflvlftghheafaqnvharh
ayscdeiiwgghfvdvfttlpdgrraldlgkfheia

Sequence, based on observed residues (ATOM records): (download)

>d2x6aa2 b.1.18.16 (A:139-294) automated matches {Magnetospirillum magnetotacticum [TaxId: 188]}
tagvlfssrmvisdfegkptlmmrlanlrieaiieadvhlvlvrsevfrrfhdltltrsr
spifslswtvmhpidhhspiygetdetlrnshseflvlftghheafaqnvharhayscde
iiwgghfvdvfttlpdgrraldlgkfheia

SCOPe Domain Coordinates for d2x6aa2:

Click to download the PDB-style file with coordinates for d2x6aa2.
(The format of our PDB-style files is described here.)

Timeline for d2x6aa2: