| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.16: Cytoplasmic domain of inward rectifier potassium channel [81966] (4 proteins) |
| Protein automated matches [190782] (2 species) not a true protein |
| Species Magnetospirillum magnetotacticum [TaxId:188] [229112] (5 PDB entries) |
| Domain d2x6aa2: 2x6a A:139-294 [244440] Other proteins in same PDB: d2x6aa1, d2x6aa3 automated match to d2wlka2 complexed with k, pc |
PDB Entry: 2x6a (more details), 3.1 Å
SCOPe Domain Sequences for d2x6aa2:
Sequence, based on SEQRES records: (download)
>d2x6aa2 b.1.18.16 (A:139-294) automated matches {Magnetospirillum magnetotacticum [TaxId: 188]}
tagvlfssrmvisdfegkptlmmrlanlrieaiieadvhlvlvrsevsqegmvfrrfhdl
tltrsrspifslswtvmhpidhhspiygetdetlrnshseflvlftghheafaqnvharh
ayscdeiiwgghfvdvfttlpdgrraldlgkfheia
>d2x6aa2 b.1.18.16 (A:139-294) automated matches {Magnetospirillum magnetotacticum [TaxId: 188]}
tagvlfssrmvisdfegkptlmmrlanlrieaiieadvhlvlvrsevfrrfhdltltrsr
spifslswtvmhpidhhspiygetdetlrnshseflvlftghheafaqnvharhayscde
iiwgghfvdvfttlpdgrraldlgkfheia
Timeline for d2x6aa2: