Lineage for d2x5vh1 (2x5v H:1-36)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253581Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2254169Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (2 families) (S)
  5. 2254289Family f.23.10.0: automated matches [227192] (1 protein)
    not a true family
  6. 2254290Protein automated matches [226917] (3 species)
    not a true protein
  7. 2254291Species Blastochloris viridis [TaxId:1079] [232250] (4 PDB entries)
  8. 2254295Domain d2x5vh1: 2x5v H:1-36 [244434]
    Other proteins in same PDB: d2x5vc_, d2x5vh2, d2x5vl_, d2x5vm_
    automated match to d2wjnh1
    complexed with bcb, bpb, fe2, hem, mq7

Details for d2x5vh1

PDB Entry: 2x5v (more details), 3 Å

PDB Description: 80 microsecond laue diffraction snapshot from crystals of a photosynthetic reaction centre 3 millisecond following photoactivation.
PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d2x5vh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x5vh1 f.23.10.0 (H:1-36) automated matches {Blastochloris viridis [TaxId: 1079]}
myhgalaqhldiaqlvwyaqwlviwtvvllylrred

SCOPe Domain Coordinates for d2x5vh1:

Click to download the PDB-style file with coordinates for d2x5vh1.
(The format of our PDB-style files is described here.)

Timeline for d2x5vh1: