SCOP 1.71: Domain d1eg9a1: 1eg9 A:1-154

Lineage for d1eg9a1 (1eg9 A:1-154)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (2 families)

5. Family b.33.1.2: Ring hydroxylating alpha subunit ISP domain [50033] (2 proteins)

6. Protein Naphthalene 1,2-dioxygenase alpha subunit, N-domain [50034] (1 species)

7. Species Pseudomonas putida [TaxId:303] [50035] (8 PDB entries)

8. Domain d1eg9a1: 1eg9 A:1-154 [24443]
   Other proteins in same PDB: d1eg9a2, d1eg9b_
   complexed with fes, ind, of1, so4

Details for d1eg9a1

PDB Entry: 1eg9, 1.6 Å

PDB Description: naphthalene 1,2-dioxygenase with indole bound in the active site.

SCOP Domain Sequences for d1eg9a1:

Sequence; same for both SEQRES and ATOM records:

>d1eg9a1 b.33.1.2 (A:1-154) Naphthalene 1,2-dioxygenase alpha subunit, N-domain {Pseudomonas putida}
mnynnkilvsesglsqkhlihgdeelfqhelktifarnwlflthdslipapgdyvtakmg
idevivsrqndgsiraflnvcrhrgktlvsveagnakgfvcsyhgwgfgsngelqsvpfe
kdlygeslnkkclglkevarvesfhgfiygcfdq

Timeline for d1eg9a1:

• d1eg9a1 first appeared (with stable ids) in SCOP 1.55
  
• d1eg9a1 appears in SCOP 1.69
  
• d1eg9a1 appears in SCOP 1.73
  
• d1eg9a1 appears in the current release, SCOPe 2.08