Lineage for d1eg9a1 (1eg9 A:1-154)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13012Fold b.33: ISP domain [50021] (1 superfamily)
  4. 13013Superfamily b.33.1: ISP domain [50022] (2 families) (S)
  5. 13040Family b.33.1.2: Naphthalene 1,2-dioxygenase alpha subunit, N-domain [50033] (1 protein)
  6. 13041Protein Naphthalene 1,2-dioxygenase alpha subunit, N-domain [50034] (1 species)
  7. 13042Species Pseudomonas putida [TaxId:303] [50035] (2 PDB entries)
  8. 13043Domain d1eg9a1: 1eg9 A:1-154 [24443]
    Other proteins in same PDB: d1eg9a2, d1eg9b_

Details for d1eg9a1

PDB Entry: 1eg9 (more details), 1.6 Å

PDB Description: naphthalene 1,2-dioxygenase with indole bound in the active site.

SCOP Domain Sequences for d1eg9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eg9a1 b.33.1.2 (A:1-154) Naphthalene 1,2-dioxygenase alpha subunit, N-domain {Pseudomonas putida}
mnynnkilvsesglsqkhlihgdeelfqhelktifarnwlflthdslipapgdyvtakmg
idevivsrqndgsiraflnvcrhrgktlvsveagnakgfvcsyhgwgfgsngelqsvpfe
kdlygeslnkkclglkevarvesfhgfiygcfdq

SCOP Domain Coordinates for d1eg9a1:

Click to download the PDB-style file with coordinates for d1eg9a1.
(The format of our PDB-style files is described here.)

Timeline for d1eg9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1eg9a2
View in 3D
Domains from other chains:
(mouse over for more information)
d1eg9b_