Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (2 families) |
Family f.23.10.0: automated matches [227192] (1 protein) not a true family |
Protein automated matches [226917] (3 species) not a true protein |
Species Blastochloris viridis [TaxId:1079] [232250] (4 PDB entries) |
Domain d2x5uh1: 2x5u H:1-36 [244429] Other proteins in same PDB: d2x5uc_, d2x5uh2, d2x5ul_, d2x5um_ automated match to d2wjnh1 complexed with bcb, bpb, fe2, hem, mq7 |
PDB Entry: 2x5u (more details), 3 Å
SCOPe Domain Sequences for d2x5uh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x5uh1 f.23.10.0 (H:1-36) automated matches {Blastochloris viridis [TaxId: 1079]} myhgalaqhldiaqlvwyaqwlviwtvvllylrred
Timeline for d2x5uh1: