Lineage for d2x5uh1 (2x5u H:1-36)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577985Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2578573Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (2 families) (S)
  5. 2578693Family f.23.10.0: automated matches [227192] (1 protein)
    not a true family
  6. 2578694Protein automated matches [226917] (3 species)
    not a true protein
  7. 2578695Species Blastochloris viridis [TaxId:1079] [232250] (5 PDB entries)
  8. 2578698Domain d2x5uh1: 2x5u H:1-36 [244429]
    Other proteins in same PDB: d2x5uc_, d2x5uh2, d2x5ul_, d2x5um_
    automated match to d2wjnh1
    complexed with bcb, bpb, fe2, hem, mq7

Details for d2x5uh1

PDB Entry: 2x5u (more details), 3 Å

PDB Description: 80 microsecond laue diffraction snapshot from crystals of a photosynthetic reaction centre without illumination.
PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d2x5uh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x5uh1 f.23.10.0 (H:1-36) automated matches {Blastochloris viridis [TaxId: 1079]}
myhgalaqhldiaqlvwyaqwlviwtvvllylrred

SCOPe Domain Coordinates for d2x5uh1:

Click to download the PDB-style file with coordinates for d2x5uh1.
(The format of our PDB-style files is described here.)

Timeline for d2x5uh1: