Lineage for d1g8jd_ (1g8j D:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13012Fold b.33: ISP domain [50021] (1 superfamily)
  4. 13013Superfamily b.33.1: ISP domain [50022] (2 families) (S)
  5. 13014Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (4 proteins)
  6. Protein Arsenite oxidase Rieske subunit [50029] (1 species)
  7. Species Alcaligenes faecalis [TaxId:511] [50030] (2 PDB entries)
  8. Domain d1g8jd_: 1g8j D: [24440]
    Other proteins in same PDB: d1g8ja1, d1g8ja2, d1g8jc1, d1g8jc2

Details for d1g8jd_

PDB Entry: 1g8j (more details), 2.03 Å

PDB Description: crystal structure analysis of arsenite oxidase from alcaligenes faecalis

SCOP Domain Sequences for d1g8jd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g8jd_ b.33.1.1 (D:) Arsenite oxidase Rieske subunit {Alcaligenes faecalis}
aypatavsvaknlaanepssftypdtsspcvavklgapvpggvgpdddivaysvlcthmg
cptsydsssktfscpchftefdaekagqmicgeatadlprvllrydaasdaltavgvdgl
iygrqanvi

SCOP Domain Coordinates for d1g8jd_ are not available.

Timeline for d1g8jd_:

Domains from other chains:
(mouse over for more information)
d1g8ja1, d1g8ja2, d1g8jb_, d1g8jc1, d1g8jc2