Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
Protein automated matches [190036] (60 species) not a true protein |
Species Pyrococcus furiosus [TaxId:2261] [187908] (4 PDB entries) |
Domain d2x17o_: 2x17 O: [244397] automated match to d2jd60_ complexed with ag |
PDB Entry: 2x17 (more details), 3.1 Å
SCOPe Domain Sequences for d2x17o_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x17o_ a.25.1.0 (O:) automated matches {Pyrococcus furiosus [TaxId: 2261]} mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpgllm
Timeline for d2x17o_: