Lineage for d1g8kd_ (1g8k D:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13012Fold b.33: ISP domain [50021] (1 superfamily)
  4. 13013Superfamily b.33.1: ISP domain [50022] (2 families) (S)
  5. 13014Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (4 proteins)
  6. Protein Arsenite oxidase Rieske subunit [50029] (1 species)
  7. Species Alcaligenes faecalis [TaxId:511] [50030] (2 PDB entries)
  8. Domain d1g8kd_: 1g8k D: [24436]
    Other proteins in same PDB: d1g8ka1, d1g8ka2, d1g8kc1, d1g8kc2, d1g8ke1, d1g8ke2, d1g8kg1, d1g8kg2

Details for d1g8kd_

PDB Entry: 1g8k (more details), 1.64 Å

PDB Description: crystal structure analysis of arsenite oxidase from alcaligenes faecalis

SCOP Domain Sequences for d1g8kd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g8kd_ b.33.1.1 (D:) Arsenite oxidase Rieske subunit {Alcaligenes faecalis}
rttlaypatavsvaknlaanepvsftypdtsspcvavklgapvpggvgpdddivaysvlc
thmgcptsydsssktfscpchftefdaekagqmicgeatadlprvllrydaasdaltavg
vdgliygrqanvi

SCOP Domain Coordinates for d1g8kd_ are not available.

Timeline for d1g8kd_:

Domains from other chains:
(mouse over for more information)
d1g8ka1, d1g8ka2, d1g8kb_, d1g8kc1, d1g8kc2, d1g8ke1, d1g8ke2, d1g8kf_, d1g8kg1, d1g8kg2, d1g8kh_