SCOPe 2.06: Domain d2wy3c_: 2wy3 C:

Lineage for d2wy3c_ (2wy3 C:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226044] (65 PDB entries)

8. Domain d2wy3c_: 2wy3 C: [244354]
   automated match to d1tmca_
   complexed with act, nag, peu

Details for d2wy3c_

PDB Entry: 2wy3, 1.8 Å

PDB Description: structure of the hcmv ul16-micb complex elucidates select binding of a viral immunoevasin to diverse nkg2d ligands

PDB Compounds: (C:) MHC class I polypeptide-related sequence b

SCOPe Domain Sequences for d2wy3c_:

Sequence, based on SEQRES records:

>d2wy3c_ d.19.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ephslrynlmvlsqdesvqsgflaeghldgqpflrydrqkrrakpqgqwaedvlgaetwd
tetedltengqdlrrtlthikdqkgglhslqeirvceihedsstrgsrhfyyngelflsq
nletqestvpqssraqtlamnvtnfwkedamktkthyramqadclqklqrylksg

Sequence, based on observed residues (ATOM records):

>d2wy3c_ d.19.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ephslrynlmvlsqdesvqsgflaeghldgqpflrydrqkrrakpqgqwaedvlgaetwd
tetedltengqdlrrtlthilhslqeirvceihedsstrgsrhfyyngelflsqnletqe
stvpqssraqtlamnvtnfwkamktkthyramqadclqklqrylksg

Timeline for d2wy3c_:

• d2wy3c_ first appeared in SCOPe 2.04
  
• d2wy3c_ appears in SCOPe 2.05
  
• d2wy3c_ appears in SCOPe 2.07
  
• d2wy3c_ appears in the current release, SCOPe 2.08