Lineage for d3bcce1 (3bcc E:70-196)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 295512Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 295513Superfamily b.33.1: ISP domain [50022] (2 families) (S)
  5. 295514Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (6 proteins)
  6. 295526Protein ISP subunit of the mitochondrial cytochrome bc1-complex, watersoluble domain [50024] (3 species)
  7. 295533Species Chicken (Gallus gallus) [TaxId:9031] [50026] (3 PDB entries)
  8. 295536Domain d3bcce1: 3bcc E:70-196 [24433]
    Other proteins in same PDB: d3bcca1, d3bcca2, d3bccb1, d3bccb2, d3bccc2, d3bccc3, d3bccd2, d3bccd3, d3bcce2, d3bccf_, d3bccg_, d3bcch_, d3bccj_
    complexed with amy, fes, hem, sig

Details for d3bcce1

PDB Entry: 3bcc (more details), 3.7 Å

PDB Description: stigmatellin and antimycin bound cytochrome bc1 complex from chicken

SCOP Domain Sequences for d3bcce1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bcce1 b.33.1.1 (E:70-196) ISP subunit of the mitochondrial cytochrome bc1-complex, watersoluble domain {Chicken (Gallus gallus)}
amskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdpqhdlervkk
pewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnlevpsyefts
ddmvivg

SCOP Domain Coordinates for d3bcce1:

Click to download the PDB-style file with coordinates for d3bcce1.
(The format of our PDB-style files is described here.)

Timeline for d3bcce1: