Lineage for d3bcce1 (3bcc E:70-196)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 165342Fold b.33: ISP domain [50021] (1 superfamily)
  4. 165343Superfamily b.33.1: ISP domain [50022] (2 families) (S)
  5. 165344Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (5 proteins)
  6. 165356Protein ISP subunit of the mitochondrial cytochrome bc1-complex, watersoluble domain [50024] (3 species)
  7. 165361Species Chicken (Gallus gallus) [TaxId:9031] [50026] (3 PDB entries)
  8. 165364Domain d3bcce1: 3bcc E:70-196 [24433]
    Other proteins in same PDB: d3bcca1, d3bcca2, d3bccb1, d3bccb2, d3bccc1, d3bccd2, d3bccd3, d3bcce2, d3bccf1, d3bccg1, d3bcch1, d3bccj1

Details for d3bcce1

PDB Entry: 3bcc (more details), 3.7 Å

PDB Description: stigmatellin and antimycin bound cytochrome bc1 complex from chicken

SCOP Domain Sequences for d3bcce1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bcce1 b.33.1.1 (E:70-196) ISP subunit of the mitochondrial cytochrome bc1-complex, watersoluble domain {Chicken (Gallus gallus)}
amskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdpqhdlervkk
pewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnlevpsyefts
ddmvivg

SCOP Domain Coordinates for d3bcce1:

Click to download the PDB-style file with coordinates for d3bcce1.
(The format of our PDB-style files is described here.)

Timeline for d3bcce1: