SCOP 1.55: Domain d3bcce1: 3bcc E:70-196

Lineage for d3bcce1 (3bcc E:70-196)

Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds)
Fold b.33: ISP domain [50021] (1 superfamily)
Superfamily b.33.1: ISP domain [50022] (2 families)
Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (4 proteins)
Protein ISP subunit of the mitochondrial cytochrome bc1-complex, watersoluble domain [50024] (2 species)
Species Chicken (Gallus gallus) [TaxId:9031] [50026] (3 PDB entries)
Domain d3bcce1: 3bcc E:70-196 [24433]
Other proteins in same PDB: d3bcca_, d3bccb_, d3bccc1, d3bccd2, d3bccd3, d3bcce2, d3bccf1, d3bccg1, d3bcch1, d3bccj1

Details for d3bcce1

PDB Entry: 3bcc (more details), 3.7 Å

PDB Description: stigmatellin and antimycin bound cytochrome bc1 complex from chicken

SCOP Domain Sequences for d3bcce1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bcce1 b.33.1.1 (E:70-196) ISP subunit of the mitochondrial cytochrome bc1-complex, watersoluble domain {Chicken (Gallus gallus)}
amskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdpqhdlervkk
pewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnlevpsyefts
ddmvivg

SCOP Domain Coordinates for d3bcce1:

Click to download the PDB-style file with coordinates for d3bcce1.
(The format of our PDB-style files is described here.)

Timeline for d3bcce1: