Lineage for d2wvge2 (2wvg E:188-362)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2862578Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2862579Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2863020Family c.31.1.0: automated matches [191352] (1 protein)
    not a true family
  6. 2863021Protein automated matches [190312] (14 species)
    not a true protein
  7. 2863135Species Zymomonas mobilis [TaxId:542] [255669] (6 PDB entries)
  8. 2863144Domain d2wvge2: 2wvg E:188-362 [244320]
    Other proteins in same PDB: d2wvga1, d2wvga3, d2wvgb1, d2wvgb3, d2wvge1, d2wvge3, d2wvgf1, d2wvgf3
    automated match to d1zpda1
    complexed with f, mg, tpu

Details for d2wvge2

PDB Entry: 2wvg (more details), 1.75 Å

PDB Description: structural insights into the pre-reaction state of pyruvate decarboxylase from zymomonas mobilis
PDB Compounds: (E:) pyruvate decarboxylase

SCOPe Domain Sequences for d2wvge2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wvge2 c.31.1.0 (E:188-362) automated matches {Zymomonas mobilis [TaxId: 542]}
easdeaslnaaveetlkfianrdkvavlvgsklraagaeeaavkfadalggavatmaaak
sffpeenphyigtswgevsypgvektmkeadavialapvfndysttgwtdipdpkklvla
eprsvvvngirfpsvhlkdyltrlaqkvskktgaldffkslnagelkkaapadps

SCOPe Domain Coordinates for d2wvge2:

Click to download the PDB-style file with coordinates for d2wvge2.
(The format of our PDB-style files is described here.)

Timeline for d2wvge2: