Lineage for d2bcce1 (2bcc E:70-196)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58227Fold b.33: ISP domain [50021] (1 superfamily)
  4. 58228Superfamily b.33.1: ISP domain [50022] (2 families) (S)
  5. 58229Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (4 proteins)
  6. 58241Protein ISP subunit of the mitochondrial cytochrome bc1-complex, watersoluble domain [50024] (3 species)
  7. 58244Species Chicken (Gallus gallus) [TaxId:9031] [50026] (3 PDB entries)
  8. 58246Domain d2bcce1: 2bcc E:70-196 [24432]
    Other proteins in same PDB: d2bcca1, d2bcca2, d2bccb1, d2bccb2, d2bccc1, d2bccd2, d2bccd3, d2bcce2, d2bccf1, d2bccg1, d2bcch1, d2bccj1

Details for d2bcce1

PDB Entry: 2bcc (more details), 3.5 Å

PDB Description: stigmatellin-bound cytochrome bc1 complex from chicken

SCOP Domain Sequences for d2bcce1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bcce1 b.33.1.1 (E:70-196) ISP subunit of the mitochondrial cytochrome bc1-complex, watersoluble domain {Chicken (Gallus gallus)}
amskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdpqhdlervkk
pewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnlevpsyefts
ddmvivg

SCOP Domain Coordinates for d2bcce1:

Click to download the PDB-style file with coordinates for d2bcce1.
(The format of our PDB-style files is described here.)

Timeline for d2bcce1: