Lineage for d1bgyq1 (1bgy Q:70-196)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 295512Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 295513Superfamily b.33.1: ISP domain [50022] (2 families) (S)
  5. 295514Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (6 proteins)
  6. 295526Protein ISP subunit of the mitochondrial cytochrome bc1-complex, watersoluble domain [50024] (3 species)
  7. 295537Species Cow (Bos taurus) [TaxId:9913] [50025] (6 PDB entries)
  8. 295543Domain d1bgyq1: 1bgy Q:70-196 [24430]
    Other proteins in same PDB: d1bgya1, d1bgya2, d1bgyb1, d1bgyb2, d1bgyc2, d1bgyc3, d1bgyd2, d1bgyd3, d1bgye_, d1bgyf_, d1bgyg_, d1bgyh_, d1bgyj_, d1bgyk_, d1bgym1, d1bgym2, d1bgyn1, d1bgyn2, d1bgyo2, d1bgyo3, d1bgyp2, d1bgyp3, d1bgyq2, d1bgyr_, d1bgys_, d1bgyt_, d1bgyv_, d1bgyw_
    complexed with fes, hec, hem

Details for d1bgyq1

PDB Entry: 1bgy (more details), 3 Å

PDB Description: cytochrome bc1 complex from bovine

SCOP Domain Sequences for d1bgyq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bgyq1 b.33.1.1 (Q:70-196) ISP subunit of the mitochondrial cytochrome bc1-complex, watersoluble domain {Cow (Bos taurus)}
amskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdpqhdlervkk
pewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnlevpsyefts
ddmvivg

SCOP Domain Coordinates for d1bgyq1:

Click to download the PDB-style file with coordinates for d1bgyq1.
(The format of our PDB-style files is described here.)

Timeline for d1bgyq1: