Lineage for d1bgyq1 (1bgy Q:70-196)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 165342Fold b.33: ISP domain [50021] (1 superfamily)
  4. 165343Superfamily b.33.1: ISP domain [50022] (2 families) (S)
  5. 165344Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (5 proteins)
  6. 165356Protein ISP subunit of the mitochondrial cytochrome bc1-complex, watersoluble domain [50024] (3 species)
  7. 165365Species Cow (Bos taurus) [TaxId:9913] [50025] (4 PDB entries)
  8. 165369Domain d1bgyq1: 1bgy Q:70-196 [24430]
    Other proteins in same PDB: d1bgya1, d1bgya2, d1bgyb1, d1bgyb2, d1bgyc1, d1bgyd2, d1bgyd3, d1bgye1, d1bgyf1, d1bgyg1, d1bgyh1, d1bgyj1, d1bgyk1, d1bgym1, d1bgym2, d1bgyn1, d1bgyn2, d1bgyo1, d1bgyp2, d1bgyp3, d1bgyq2, d1bgyr1, d1bgys1, d1bgyt1, d1bgyv1, d1bgyw1

Details for d1bgyq1

PDB Entry: 1bgy (more details), 3 Å

PDB Description: cytochrome bc1 complex from bovine

SCOP Domain Sequences for d1bgyq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bgyq1 b.33.1.1 (Q:70-196) ISP subunit of the mitochondrial cytochrome bc1-complex, watersoluble domain {Cow (Bos taurus)}
amskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdpqhdlervkk
pewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnlevpsyefts
ddmvivg

SCOP Domain Coordinates for d1bgyq1:

Click to download the PDB-style file with coordinates for d1bgyq1.
(The format of our PDB-style files is described here.)

Timeline for d1bgyq1: