Lineage for d1be3e1 (1be3 E:70-196)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 461110Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 461111Superfamily b.33.1: ISP domain [50022] (2 families) (S)
  5. 461112Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (8 proteins)
  6. 461130Protein ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain [50024] (3 species)
  7. 461146Species Cow (Bos taurus) [TaxId:9913] [50025] (10 PDB entries)
  8. 461152Domain d1be3e1: 1be3 E:70-196 [24428]
    Other proteins in same PDB: d1be3a1, d1be3a2, d1be3b1, d1be3b2, d1be3c2, d1be3c3, d1be3d2, d1be3d3, d1be3e2, d1be3f_, d1be3g_, d1be3h_, d1be3j_, d1be3k_

Details for d1be3e1

PDB Entry: 1be3 (more details), 3 Å

PDB Description: cytochrome bc1 complex from bovine

SCOP Domain Sequences for d1be3e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1be3e1 b.33.1.1 (E:70-196) ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain {Cow (Bos taurus)}
amskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdpqhdlervkk
pewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnlevpsyefts
ddmvivg

SCOP Domain Coordinates for d1be3e1:

Click to download the PDB-style file with coordinates for d1be3e1.
(The format of our PDB-style files is described here.)

Timeline for d1be3e1: