SCOPe 2.08: Domain d2wt9b_: 2wt9 B:

Lineage for d2wt9b_ (2wt9 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families)

5. Family c.33.1.0: automated matches [191389] (1 protein)
   not a true family

6. Protein automated matches [190499] (26 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:509173] [255667] (2 PDB entries)

8. Domain d2wt9b_: 2wt9 B: [244279]
   automated match to d3hu5a_
   complexed with gol, nio, zn

Details for d2wt9b_

PDB Entry: 2wt9, 1.65 Å

PDB Description: acinetobacter baumanii nicotinamidase pyrazinamidease

PDB Compounds: (B:) Nicotinamidase

SCOPe Domain Sequences for d2wt9b_:

Sequence; same for both SEQRES and ATOM records:

>d2wt9b_ c.33.1.0 (B:) automated matches {Acinetobacter baumannii [TaxId: 509173]}
kqpqnsalvvvdvqngftpggnlavadadtiiptinqlagcfenvvltqdwhpdnhisfa
anhpgkqpfetieldygsqvlwpkhciqgthdaefhpdlniptaqliirkgfhahidsys
afmeadhttmtgltgylkergidtvyvvgiatdfcvawtaldavkqgfktlviedackgi
dlngsleqawqtmqqqgvvriqstdlln

Timeline for d2wt9b_:

• d2wt9b_ first appeared in SCOPe 2.04
  
• d2wt9b_ appears in SCOPe 2.07