SCOP 1.65: Domain d1rie__: 1rie -

Lineage for d1rie__ (1rie -)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (2 families)

5. Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (6 proteins)

6. Protein ISP subunit of the mitochondrial cytochrome bc1-complex, watersoluble domain [50024] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50025] (6 PDB entries)

8. Domain d1rie__: 1rie - [24427]
   complexed with fes

Details for d1rie__

PDB Entry: 1rie, 1.5 Å

PDB Description: structure of a water soluble fragment of the rieske iron-sulfur protein of the bovine heart mitochondrial cytochrome bc1-complex

SCOP Domain Sequences for d1rie__:

Sequence; same for both SEQRES and ATOM records:

>d1rie__ b.33.1.1 (-) ISP subunit of the mitochondrial cytochrome bc1-complex, watersoluble domain {Cow (Bos taurus)}
amskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdpqhdlervkk
pewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnlevpsyefts
ddmvivg

Timeline for d1rie__:

• d1rie__ first appeared (with stable ids) in SCOP 1.55
  
• d1rie__ appears in SCOP 1.63
  
• d1rie__ appears in SCOP 1.67
  
• d1rie__ appears in the current release, SCOPe 2.08, called d1riea_