Class b: All beta proteins [48724] (126 folds) |
Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (2 families) |
Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (6 proteins) |
Protein ISP subunit of the mitochondrial cytochrome bc1-complex, watersoluble domain [50024] (3 species) |
Species Cow (Bos taurus) [TaxId:9913] [50025] (6 PDB entries) |
Domain d1rie__: 1rie - [24427] complexed with fes |
PDB Entry: 1rie (more details), 1.5 Å
SCOP Domain Sequences for d1rie__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rie__ b.33.1.1 (-) ISP subunit of the mitochondrial cytochrome bc1-complex, watersoluble domain {Cow (Bos taurus)} amskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdpqhdlervkk pewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnlevpsyefts ddmvivg
Timeline for d1rie__: