Lineage for d1rie__ (1rie -)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58227Fold b.33: ISP domain [50021] (1 superfamily)
  4. 58228Superfamily b.33.1: ISP domain [50022] (2 families) (S)
  5. 58229Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (4 proteins)
  6. 58241Protein ISP subunit of the mitochondrial cytochrome bc1-complex, watersoluble domain [50024] (3 species)
  7. 58248Species Cow (Bos taurus) [TaxId:9913] [50025] (4 PDB entries)
  8. 58249Domain d1rie__: 1rie - [24427]

Details for d1rie__

PDB Entry: 1rie (more details), 1.5 Å

PDB Description: structure of a water soluble fragment of the rieske iron-sulfur protein of the bovine heart mitochondrial cytochrome bc1-complex

SCOP Domain Sequences for d1rie__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rie__ b.33.1.1 (-) ISP subunit of the mitochondrial cytochrome bc1-complex, watersoluble domain {Cow (Bos taurus)}
amskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdpqhdlervkk
pewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnlevpsyefts
ddmvivg

SCOP Domain Coordinates for d1rie__:

Click to download the PDB-style file with coordinates for d1rie__.
(The format of our PDB-style files is described here.)

Timeline for d1rie__: