SCOPe 2.08: Domain d2wrec1: 2wre C:8-324

Lineage for d2wrec1 (2wre C:8-324)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (58 species)
   not a true protein

7. Species Influenza A virus (a/japan/305+/1957(h2n2)) [TaxId:382813] [255658] (2 PDB entries)

8. Domain d2wrec1: 2wre C:8-324 [244242]
   Other proteins in same PDB: d2wrea2, d2wreb2, d2wrec2
   automated match to d1ha0a1

Details for d2wrec1

PDB Entry: 2wre, 3 Å

PDB Description: structure of h2 japan hemagglutinin with human receptor

PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d2wrec1:

Sequence; same for both SEQRES and ATOM records:

>d2wrec1 b.19.1.0 (C:8-324) automated matches {Influenza A virus (a/japan/305+/1957(h2n2)) [TaxId: 382813]}
cigyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsiagwllg
npecdrllsvpewsyimekenprdglcypgsfndyeelkhllssvkhfekvkilpkdrwt
qhtttggsqacavsgnpsffrnmvwltkkgsnypvakgsynntsgeqmliiwgvhhpide
keqrtlyqnvgtyvsvgtstlnkrstpeiatrpkvnglgsrmefswtlldmwdtinfest
gnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhpltigecpk
yvkseklvlatglrnvp

Timeline for d2wrec1:

• d2wrec1 first appeared in SCOPe 2.04
  
• d2wrec1 appears in SCOPe 2.07