Class b: All beta proteins [48724] (180 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
Protein automated matches [227017] (58 species) not a true protein |
Species Influenza A virus (a/japan/305+/1957(h2n2)) [TaxId:382813] [255658] (2 PDB entries) |
Domain d2wrec1: 2wre C:8-324 [244242] Other proteins in same PDB: d2wrea2, d2wreb2, d2wrec2 automated match to d1ha0a1 |
PDB Entry: 2wre (more details), 3 Å
SCOPe Domain Sequences for d2wrec1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wrec1 b.19.1.0 (C:8-324) automated matches {Influenza A virus (a/japan/305+/1957(h2n2)) [TaxId: 382813]} cigyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsiagwllg npecdrllsvpewsyimekenprdglcypgsfndyeelkhllssvkhfekvkilpkdrwt qhtttggsqacavsgnpsffrnmvwltkkgsnypvakgsynntsgeqmliiwgvhhpide keqrtlyqnvgtyvsvgtstlnkrstpeiatrpkvnglgsrmefswtlldmwdtinfest gnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhpltigecpk yvkseklvlatglrnvp
Timeline for d2wrec1:
View in 3D Domains from other chains: (mouse over for more information) d2wrea1, d2wrea2, d2wreb1, d2wreb2 |