Lineage for d1es6a_ (1es6 A:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 227464Fold b.31: EV matrix protein [50011] (1 superfamily)
    consists of two beta-sandwich domains of similar topologies
  4. 227465Superfamily b.31.1: EV matrix protein [50012] (1 family) (S)
  5. 227466Family b.31.1.1: EV matrix protein [50013] (1 protein)
  6. 227467Protein EV matrix protein [50014] (1 species)
  7. 227468Species Ebola virus [TaxId:205488] [50015] (1 PDB entry)
  8. 227469Domain d1es6a_: 1es6 A: [24424]
    mutant

Details for d1es6a_

PDB Entry: 1es6 (more details), 2 Å

PDB Description: crystal structure of the matrix protein of ebola virus

SCOP Domain Sequences for d1es6a_:

Sequence, based on SEQRES records: (download)

>d1es6a_ b.31.1.1 (A:) EV matrix protein {Ebola virus}
gdtpsnplrpiaddtidhashtpgsvssafileamvnvisgpkvlmkqipiwlplgvadq
ktysfdsttaaimlasytithfgkatnplvrvnrlgpgipdhplrllrignqaflqefvl
ppvqlpqyftfdltalklitqplpaatwtddtptgsngalrpgisfhpklrpillpnksg
kkgnsadltspekiqaimtslqdfkivpidptknimgievpetlvlkltgkkvtskngqp
iipvllpkyigldpvapgdltmvitqdcdtchspaslp

Sequence, based on observed residues (ATOM records): (download)

>d1es6a_ b.31.1.1 (A:) EV matrix protein {Ebola virus}
gdtpsnplrpiaddtidhashtpgsvssafileamvnvisgpkvlmkqipiwlplgvadq
ktysfdsttaaimlasytithfgkatnplvrvnrlgpgipdhplrllrignqaflqefvl
ppvqlpqyftfdltalklitqplpaatwtddgalrpgisfhpklrpillpnknsadltsp
ekiqaimtslqdfkivpidptknimgievpetlvlkltggqpiipvllpkyigldpvapg
dltmvitqdcdtchspaslp

SCOP Domain Coordinates for d1es6a_:

Click to download the PDB-style file with coordinates for d1es6a_.
(The format of our PDB-style files is described here.)

Timeline for d1es6a_: