SCOPe 2.04: Domain d2wq8a2: 2wq8 A:151-537

Lineage for d2wq8a2 (2wq8 A:151-537)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.1: Galactose oxidase, central domain [50965] (1 family)

5. Family b.69.1.1: Galactose oxidase, central domain [50966] (2 proteins)

6. Protein automated matches [254521] (1 species)
   not a true protein

7. Species Fusarium graminearum (Gibberella zeae) [TaxId:5518] [255146] (2 PDB entries)

8. Domain d2wq8a2: 2wq8 A:151-537 [244208]
   Other proteins in same PDB: d2wq8a1, d2wq8a3
   automated match to d1gofa3
   complexed with acy, ca, cu, edo, gol

Details for d2wq8a2

PDB Entry: 2wq8, 2.19 Å

PDB Description: glycan labelling using engineered variants of galactose oxidase obtained by directed evolution

PDB Compounds: (A:) Galactose oxidase

SCOPe Domain Sequences for d2wq8a2:

Sequence; same for both SEQRES and ATOM records:

>d2wq8a2 b.69.1.1 (A:151-537) automated matches {Fusarium graminearum (Gibberella zeae) [TaxId: 5518]}
ytapqpglgrwgptidlpivpaaaaieptsgrvlmwssyrndafegspggitltsswdps
tgivsdrtvtvtkhdmfcpgismdgngqivvtggndakktslydsssdswipgpdmqvar
gyqssatmsdgrvftiggsfsggvfekngevyspssktwtslpnakvnpmltadkqglyk
sdnhawlfgwkkgsvfqagpstamnwyytsgsgdvksagkrqsnrgvapdamcgnavmyd
avkgkiltfggspdytdsdattnahiitlgepgtspntvfasnglyfartfhtsvvlpdg
stfitggqrrgiifedstpvftpeiyvpeqdtfykqnpnsivrayhsislllpdgrvfng
ggglcgdcttnhfdaqiftpnylydsn

Timeline for d2wq8a2:

• d2wq8a2 is new in SCOPe 2.04-stable
  
• d2wq8a2 appears in SCOPe 2.05
  
• d2wq8a2 appears in the current release, SCOPe 2.08