Class b: All beta proteins [48724] (180 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (51 species) not a true protein |
Species Fusarium graminearum (Gibberella zeae) [TaxId:5518] [255145] (5 PDB entries) |
Domain d2wq8a1: 2wq8 A:1-150 [244207] Other proteins in same PDB: d2wq8a2, d2wq8a3 automated match to d1gofa2 complexed with acy, ca, cu, edo, gol |
PDB Entry: 2wq8 (more details), 2.19 Å
SCOPe Domain Sequences for d2wq8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wq8a1 b.18.1.0 (A:1-150) automated matches {Fusarium graminearum (Gibberella zeae) [TaxId: 5518]} asapigsaiprnnwavtcdsaqsgnecnkaidgnkdtfwhtfygangdpkpphtytidmk ttqnvnglsvlprqdgnqngwigrhevylssdgtnwgspvasgswfadsttkysnfetrp aryvrlvaiteangqpwtsiaeinvfqass
Timeline for d2wq8a1: