Lineage for d2wlib1 (2wli B:23-138)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2629055Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 2629056Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) (S)
    Pfam PF00520
  5. 2629057Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 2629173Protein automated matches [190184] (3 species)
    not a true protein
  7. 2629176Species Magnetospirillum magnetotacticum [TaxId:188] [229110] (5 PDB entries)
  8. 2629182Domain d2wlib1: 2wli B:23-138 [244172]
    Other proteins in same PDB: d2wlia2, d2wlia3, d2wlib2, d2wlib3
    automated match to d2wlka1
    complexed with k

Details for d2wlib1

PDB Entry: 2wli (more details), 3.09 Å

PDB Description: potassium channel from magnetospirillum magnetotacticum
PDB Compounds: (B:) kirbac3.1 potassium channel

SCOPe Domain Sequences for d2wlib1:

Sequence, based on SEQRES records: (download)

>d2wlib1 f.14.1.1 (B:23-138) automated matches {Magnetospirillum magnetotacticum [TaxId: 188]}
itrlglekrgwlddhyhdlltvswpvfitlitglylvtnalfalaylacgdvienarpgs
ftdafffsvqtmatigygklipigplantlvtlealcgmlglavaasliyarftrp

Sequence, based on observed residues (ATOM records): (download)

>d2wlib1 f.14.1.1 (B:23-138) automated matches {Magnetospirillum magnetotacticum [TaxId: 188]}
itrlglddhyhdlltvswpvfitlitglylvtnalfalaylacgdvienarpgsftdaff
fsvqtmatigygklipigplantlvtlealcgmlglavaasliyarftrp

SCOPe Domain Coordinates for d2wlib1:

Click to download the PDB-style file with coordinates for d2wlib1.
(The format of our PDB-style files is described here.)

Timeline for d2wlib1: