SCOPe 2.08: Domain d2wk6b2: 2wk6 B:101-373

Lineage for d2wk6b2 (2wk6 B:101-373)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.27: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52417] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like

4. Superfamily c.27.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52418] (2 families)
   automatically mapped to Pfam PF00591

5. Family c.27.1.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52419] (4 proteins)

6. Protein automated matches [254642] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255653] (2 PDB entries)

8. Domain d2wk6b2: 2wk6 B:101-373 [244168]
   Other proteins in same PDB: d2wk6a1, d2wk6a3, d2wk6b1, d2wk6b3
   automated match to d1uoua2
   complexed with iur

Details for d2wk6b2

PDB Entry: 2wk6, 2.5 Å

PDB Description: structural features of native human thymidine phosphorylase and in complex with 5-iodouracil

PDB Compounds: (B:) thymidine phosphorylase

SCOPe Domain Sequences for d2wk6b2:

Sequence; same for both SEQRES and ATOM records:

>d2wk6b2 c.27.1.1 (B:101-373) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qlewpeawrqqlvdkhstggvgdkvslvlapalaacgckvpmisgrglghtggtldkles
ipgfnviqspeqmqvlldqagccivgqseqlvpadgilyaardvtatvdslplitasils
kklveglsalvvdvkfggaavfpnqeqarelaktlvgvgaslglrvaaaltamdkplgrc
vghaleveeallcmdgagppdlrdlvttlggallwlsghagtqaqgaarvaaalddgsal
grfermlaaqgvdpglaralcsgspaerrqllp

Timeline for d2wk6b2:

• d2wk6b2 first appeared in SCOPe 2.04
  
• d2wk6b2 appears in SCOPe 2.07