Class a: All alpha proteins [46456] (289 folds) |
Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies) 4 helices; bundle, left-handed twist; right-handed superhelix |
Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families) automatically mapped to Pfam PF02885 |
Family a.46.2.0: automated matches [254276] (1 protein) not a true family |
Protein automated matches [254641] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255652] (2 PDB entries) |
Domain d2wk6b1: 2wk6 B:35-100 [244167] Other proteins in same PDB: d2wk6a2, d2wk6a3, d2wk6b2, d2wk6b3 automated match to d1uoua1 complexed with iur |
PDB Entry: 2wk6 (more details), 2.5 Å
SCOPe Domain Sequences for d2wk6b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wk6b1 a.46.2.0 (B:35-100) automated matches {Human (Homo sapiens) [TaxId: 9606]} qlpelirmkrdggrlseadirgfvaavvngsaqgaqigamlmairlrgmdleetsvltqa laqsgq
Timeline for d2wk6b1: