SCOPe 2.06: Domain d2wggc2: 2wgg C:260-416

Lineage for d2wggc2 (2wgg C:260-416)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (60 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [196910] (11 PDB entries)

8. Domain d2wggc2: 2wgg C:260-416 [244128]
   automated match to d2wgfa2
   complexed with 2pe, na, peg, tlm

Details for d2wggc2

PDB Entry: 2wgg, 2 Å

PDB Description: Crystal Structure of Mycobacterium tuberculosis C171Q KasA variant with bound TLM

PDB Compounds: (C:) 3-oxoacyl-[acyl-carrier-protein] synthase 1

SCOPe Domain Sequences for d2wggc2:

Sequence; same for both SEQRES and ATOM records:

>d2wggc2 c.95.1.0 (C:260-416) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
kplarllgagitsdafhmvapaadgvragramtrslelaglspadidhvnahgtatpigd
aaeanairvagcdqaavyapksalghsigavgalesvltvltlrdgvipptlnyetpdpe
idldvvageprygdyryavnnsfgfgghnvalafgry

Timeline for d2wggc2:

• d2wggc2 first appeared in SCOPe 2.04
  
• d2wggc2 appears in SCOPe 2.05
  
• d2wggc2 appears in SCOPe 2.07
  
• d2wggc2 appears in the current release, SCOPe 2.08