Lineage for d1avl_1 (1avl 212-628)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.30: Supersandwich [49993] (3 superfamilies) 
Superfamily b.30.2: Copper amine oxidase, domain 3 (catalytic) [49998] (1 family) 
Family b.30.2.1: Copper amine oxidase, domain 3 (catalytic) [49999] (1 protein) Protein Copper amine oxidase, domain 3 (catalytic) [50000] (4 species) 
Species Arthrobacter globiformis [TaxId:1665] [50003] (3 PDB entries) 
Domain d1avl_1: 1avl 212-628 [24412]
Other proteins in same PDB: d1avl_2, d1avl_3
Details for d1avl_1
PDB Entry: 1avl (more details), 2.8 Å
PDB Description: crystal structures of the copper-containing amine oxidase from arthrobacter globiformis in the holo-and apo-forms: implications for the biogenesis of topa quinone
SCOP Domain Sequences for d1avl_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1avl_1 b.30.2.1 (212-628) Copper amine oxidase, domain 3 (catalytic) {Arthrobacter globiformis}
plrttqkpisitqpegpsftvtggnhiewekwsldvgfdvregvvlhniafrdgdrlrpi
inrasiaemvvpygdpspirswqnyfdtgeylvgqyanslelgcdclgditylspvisda
fgnpreirngicmheedwgilakhsdlwsginytrrnrrmvisffttignadygfywyly
ldgtiefeakatgvvftsafpeggsdnisqlapglgapfhqhifsarldmaidgftnrve
eedvvrqtmgpgnergnafsrkrtvltreseavreadartgrtwiisnpesknrlnepvg
yklhahnqptlladpgssiarraafatkdlwvtryadderyptgdfvnqhsggaglpsyi
aqdrdidgqdivvwhtfglthfprvedwpimpvdtvgfklrpegffdrspvldvpan
SCOP Domain Coordinates for d1avl_1:
Click to download the PDB-style file with coordinates for d1avl_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1avl_1:
- d1avl_1 appears in SCOP 1.57
- d1avl_1 appears in the current release, SCOPe 2.08, called d1avla1
View in 3D
