Lineage for d2wc2b2 (2wc2 B:138-209)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2694741Species Escherichia coli [TaxId:469008] [255648] (1 PDB entry)
  8. 2694743Domain d2wc2b2: 2wc2 B:138-209 [244115]
    Other proteins in same PDB: d2wc2a1, d2wc2b1
    automated match to d4i02a2

Details for d2wc2b2

PDB Entry: 2wc2 (more details)

PDB Description: nmr structure of catabolite activator protein in the unliganded state
PDB Compounds: (B:) Catabolite gene activator

SCOPe Domain Sequences for d2wc2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wc2b2 a.4.5.0 (B:138-209) automated matches {Escherichia coli [TaxId: 469008]}
dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ahgktivvygtr

SCOPe Domain Coordinates for d2wc2b2:

Click to download the PDB-style file with coordinates for d2wc2b2.
(The format of our PDB-style files is described here.)

Timeline for d2wc2b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2wc2b1