SCOPe 2.05: Domain d2wc2a1: 2wc2 A:1-137

Lineage for d2wc2a1 (2wc2 A:1-137)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
   Pfam PF00027

6. Protein automated matches [190352] (8 species)
   not a true protein

7. Species Escherichia coli [TaxId:469008] [255647] (1 PDB entry)

8. Domain d2wc2a1: 2wc2 A:1-137 [244112]
   Other proteins in same PDB: d2wc2a2, d2wc2b2
   automated match to d4i02b1

Details for d2wc2a1

PDB Entry: 2wc2

PDB Description: nmr structure of catabolite activator protein in the unliganded state

PDB Compounds: (A:) Catabolite gene activator

SCOPe Domain Sequences for d2wc2a1:

Sequence; same for both SEQRES and ATOM records:

>d2wc2a1 b.82.3.2 (A:1-137) automated matches {Escherichia coli [TaxId: 469008]}
vlgkpqtdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemi
lsylnqgdfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqm
arrlqvtsekvgnlafl

Timeline for d2wc2a1:

• d2wc2a1 first appeared in SCOPe 2.04
  
• d2wc2a1 appears in SCOPe 2.06
  
• d2wc2a1 appears in the current release, SCOPe 2.08