Lineage for d1av4_1 (1av4 212-628)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 109071Fold b.30: Supersandwich [49993] (4 superfamilies)
  4. 109200Superfamily b.30.2: Copper amine oxidase, domain 3 (catalytic) [49998] (1 family) (S)
  5. 109201Family b.30.2.1: Copper amine oxidase, domain 3 (catalytic) [49999] (1 protein)
  6. 109202Protein Copper amine oxidase, domain 3 (catalytic) [50000] (4 species)
  7. 109203Species Arthrobacter globiformis [TaxId:1665] [50003] (3 PDB entries)
  8. 109204Domain d1av4_1: 1av4 212-628 [24411]
    Other proteins in same PDB: d1av4_2, d1av4_3

Details for d1av4_1

PDB Entry: 1av4 (more details), 2.2 Å

PDB Description: crystal structures of the copper-containing amine oxidase from arthrobacter globiformis in the holo-and apo-forms: implications for the biogenesis of topa quinone

SCOP Domain Sequences for d1av4_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1av4_1 b.30.2.1 (212-628) Copper amine oxidase, domain 3 (catalytic) {Arthrobacter globiformis}
plrttqkpisitqpegpsftvtggnhiewekwsldvgfdvregvvlhniafrdgdrlrpi
inrasiaemvvpygdpspirswqnyfdtgeylvgqyanslelgcdclgditylspvisda
fgnpreirngicmheedwgilakhsdlwsginytrrnrrmvisffttignadygfywyly
ldgtiefeakatgvvftsafpeggsdnisqlapglgapfhqhifsarldmaidgftnrve
eedvvrqtmgpgnergnafsrkrtvltreseavreadartgrtwiisnpesknrlnepvg
yklhahnqptlladpgssiarraafatkdlwvtryadderyptgdfvnqhsggaglpsyi
aqdrdidgqdivvwhtfglthfprvedwpimpvdtvgfklrpegffdrspvldvpan

SCOP Domain Coordinates for d1av4_1:

Click to download the PDB-style file with coordinates for d1av4_1.
(The format of our PDB-style files is described here.)

Timeline for d1av4_1: