Lineage for d2wbmb1 (2wbm B:1-87)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2240566Fold d.235: FYSH domain [89894] (1 superfamily)
    beta(2)-alpha(2)-beta(2)-alpha-beta; two layers: alpha/beta; antiparallel sheet: order 51234
  4. 2240567Superfamily d.235.1: FYSH domain [89895] (3 families) (S)
  5. 2240577Family d.235.1.0: automated matches [254274] (1 protein)
    not a true family
  6. 2240578Protein automated matches [254639] (1 species)
    not a true protein
  7. 2240579Species Methanothermobacter thermautotrophicus [TaxId:187420] [255644] (1 PDB entry)
  8. 2240581Domain d2wbmb1: 2wbm B:1-87 [244109]
    Other proteins in same PDB: d2wbma2, d2wbma3, d2wbma4, d2wbmb2, d2wbmb3
    automated match to d1p9qc2
    complexed with cl, gol, so4

Details for d2wbmb1

PDB Entry: 2wbm (more details), 1.75 Å

PDB Description: crystal structure of mthsbds, the homologue of the shwachman-bodian- diamond syndrome protein in the euriarchaeon methanothermobacter thermautotrophicus
PDB Compounds: (B:) ribosome maturation protein sdo1 homolog

SCOPe Domain Sequences for d2wbmb1:

Sequence, based on SEQRES records: (download)

>d2wbmb1 d.235.1.0 (B:1-87) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
mvsledaviarleshgerfevlvdpdlaaefrredsdvsvedvlavqevfrdarkgdkas
eeamrkvfetadplevtpvilrrgtiq

Sequence, based on observed residues (ATOM records): (download)

>d2wbmb1 d.235.1.0 (B:1-87) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
mvsledaviarleshgerfevlvdpdlaaefrvsvedvlavqevfrdarkgdkaseeamr
kvfetadplevtpvilrrgtiq

SCOPe Domain Coordinates for d2wbmb1:

Click to download the PDB-style file with coordinates for d2wbmb1.
(The format of our PDB-style files is described here.)

Timeline for d2wbmb1: