Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families) |
Family d.58.11.0: automated matches [254210] (1 protein) not a true family |
Protein automated matches [254469] (2 species) not a true protein |
Species Methanothermobacter thermautotrophicus [TaxId:187420] [255646] (1 PDB entry) |
Domain d2wbma3: 2wbm A:163-232 [244108] Other proteins in same PDB: d2wbma1, d2wbma2, d2wbma4, d2wbmb1, d2wbmb2 automated match to d1p9qc3 complexed with cl, gol, so4 |
PDB Entry: 2wbm (more details), 1.75 Å
SCOPe Domain Sequences for d2wbma3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wbma3 d.58.11.0 (A:163-232) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]} ekvrvaikipgemagsaygvisnfgkitneewqndgswiavveipgglqdsfyqklselt ggnvetrlik
Timeline for d2wbma3: