Lineage for d2wbkb4 (2wbk B:679-783)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1768157Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 1768616Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 1768617Protein automated matches [254633] (7 species)
    not a true protein
  7. 1768643Species Bacteroides thetaiotaomicron [TaxId:226186] [255613] (7 PDB entries)
  8. 1768684Domain d2wbkb4: 2wbk B:679-783 [244104]
    Other proteins in same PDB: d2wbka1, d2wbka3, d2wbkb1, d2wbkb3
    automated match to d2je8a3
    complexed with br, cl, edo, m2f

Details for d2wbkb4

PDB Entry: 2wbk (more details), 2.1 Å

PDB Description: structure of the michaelis complex of beta-mannosidase, man2a, provides insight into the conformational itinerary of mannoside hydrolysis
PDB Compounds: (B:) beta-mannosidase

SCOPe Domain Sequences for d2wbkb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wbkb4 b.1.4.0 (B:679-783) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
vlinpiqqndslsvylisdrldtmeqmtlemkvvdfdgktlgkkiqvhslevpantskcv
yrakldgwltpedcrrsflklilkdksghqvaesvhffrktkdlq

SCOPe Domain Coordinates for d2wbkb4:

Click to download the PDB-style file with coordinates for d2wbkb4.
(The format of our PDB-style files is described here.)

Timeline for d2wbkb4: