Lineage for d2wbjg2 (2wbj G:114-202)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1762660Protein automated matches [190374] (14 species)
    not a true protein
  7. 1762816Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)
  8. 1763557Domain d2wbjg2: 2wbj G:114-202 [244095]
    Other proteins in same PDB: d2wbja1, d2wbja2, d2wbjb1, d2wbjc1, d2wbje1, d2wbje2, d2wbjf1, d2wbjg1
    automated match to d2f54d2
    complexed with nag, so4

Details for d2wbjg2

PDB Entry: 2wbj (more details), 3 Å

PDB Description: tcr complex
PDB Compounds: (G:) ob tcr

SCOPe Domain Sequences for d2wbjg2:

Sequence, based on SEQRES records: (download)

>d2wbjg2 b.1.1.2 (G:114-202) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records): (download)

>d2wbjg2 b.1.1.2 (G:114-202) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksnsava
wsnksdfacanafnnsiipedtffps

SCOPe Domain Coordinates for d2wbjg2:

Click to download the PDB-style file with coordinates for d2wbjg2.
(The format of our PDB-style files is described here.)

Timeline for d2wbjg2: