SCOPe 2.05: Domain d2wbje2: 2wbj E:82-180

Lineage for d2wbje2 (2wbj E:82-180)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)

8. Domain d2wbje2: 2wbj E:82-180 [244091]
   Other proteins in same PDB: d2wbja1, d2wbjb1, d2wbjb2, d2wbjc2, d2wbje1, d2wbjf1, d2wbjf2, d2wbjg2
   automated match to d1ieaa1
   complexed with nag, so4

Details for d2wbje2

PDB Entry: 2wbj, 3 Å

PDB Description: tcr complex

PDB Compounds: (E:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d2wbje2:

Sequence; same for both SEQRES and ATOM records:

>d2wbje2 b.1.1.0 (E:82-180) automated matches {Human (Homo sapiens) [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwef

Timeline for d2wbje2:

• d2wbje2 first appeared in SCOPe 2.04
  
• d2wbje2 appears in SCOPe 2.06
  
• d2wbje2 appears in the current release, SCOPe 2.08