Lineage for d2wbje1 (2wbj E:4-81)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2545715Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2545716Protein automated matches [226842] (5 species)
    not a true protein
  7. 2545737Species Human (Homo sapiens) [TaxId:9606] [226044] (102 PDB entries)
  8. 2545903Domain d2wbje1: 2wbj E:4-81 [244090]
    Other proteins in same PDB: d2wbja2, d2wbjb1, d2wbjb2, d2wbjc1, d2wbjc2, d2wbje2, d2wbjf1, d2wbjf2, d2wbjg1, d2wbjg2
    automated match to d1fnga2
    complexed with nag, so4

Details for d2wbje1

PDB Entry: 2wbj (more details), 3 Å

PDB Description: tcr complex
PDB Compounds: (E:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d2wbje1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wbje1 d.19.1.0 (E:4-81) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalani
avdkanleimtkrsnytp

SCOPe Domain Coordinates for d2wbje1:

Click to download the PDB-style file with coordinates for d2wbje1.
(The format of our PDB-style files is described here.)

Timeline for d2wbje1: