SCOPe 2.05: Domain d2wbjc1: 2wbj C:8-113

Lineage for d2wbjc1 (2wbj C:8-113)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)

8. Domain d2wbjc1: 2wbj C:8-113 [244088]
   Other proteins in same PDB: d2wbja1, d2wbjb1, d2wbjb2, d2wbjc2, d2wbje1, d2wbjf1, d2wbjf2, d2wbjg2
   automated match to d2f54d1
   complexed with nag, so4

Details for d2wbjc1

PDB Entry: 2wbj, 3 Å

PDB Description: tcr complex

PDB Compounds: (C:) ob tcr

SCOPe Domain Sequences for d2wbjc1:

Sequence; same for both SEQRES and ATOM records:

>d2wbjc1 b.1.1.0 (C:8-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pqalsiqegenatmncsyktsinnlqwyrqnsgrglvhlilirsnerekhsgrlrvtldt
skksssllitasraadtasyfcatdttsgtykyifgtgtrlkvlpn

Timeline for d2wbjc1:

• d2wbjc1 first appeared in SCOPe 2.04
  
• d2wbjc1 appears in SCOPe 2.06
  
• d2wbjc1 appears in the current release, SCOPe 2.08