![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
![]() | Protein automated matches [226842] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [226044] (65 PDB entries) |
![]() | Domain d2wbja1: 2wbj A:3-81 [244084] Other proteins in same PDB: d2wbja2, d2wbjb1, d2wbjb2, d2wbjc1, d2wbjc2, d2wbje2, d2wbjf1, d2wbjf2, d2wbjg1, d2wbjg2 automated match to d1fnga2 complexed with nag, so4 |
PDB Entry: 2wbj (more details), 3 Å
SCOPe Domain Sequences for d2wbja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wbja1 d.19.1.0 (A:3-81) automated matches {Human (Homo sapiens) [TaxId: 9606]} eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan iavdkanleimtkrsnytp
Timeline for d2wbja1: