Lineage for d2wbja1 (2wbj A:3-81)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182595Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2182596Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2183623Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2183624Protein automated matches [226842] (4 species)
    not a true protein
  7. 2183637Species Human (Homo sapiens) [TaxId:9606] [226044] (65 PDB entries)
  8. 2183746Domain d2wbja1: 2wbj A:3-81 [244084]
    Other proteins in same PDB: d2wbja2, d2wbjb1, d2wbjb2, d2wbjc1, d2wbjc2, d2wbje2, d2wbjf1, d2wbjf2, d2wbjg1, d2wbjg2
    automated match to d1fnga2
    complexed with nag, so4

Details for d2wbja1

PDB Entry: 2wbj (more details), 3 Å

PDB Description: tcr complex
PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d2wbja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wbja1 d.19.1.0 (A:3-81) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan
iavdkanleimtkrsnytp

SCOPe Domain Coordinates for d2wbja1:

Click to download the PDB-style file with coordinates for d2wbja1.
(The format of our PDB-style files is described here.)

Timeline for d2wbja1: