Lineage for d1ksia1 (1ksi A:207-647)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) (S)
    automatically mapped to Pfam PF01179
  5. Family b.30.2.1: Amine oxidase catalytic domain [49999] (3 proteins)
  6. Protein Copper amine oxidase, domain 3 [50000] (4 species)
  7. Species Pea (Pisum sativum) [TaxId:3888] [50002] (2 PDB entries)
    Uniprot Q43077
  8. Domain d1ksia1: 1ksi A:207-647 [24408]
    Other proteins in same PDB: d1ksia2, d1ksia3, d1ksib2, d1ksib3
    complexed with cu, mn, nag

Details for d1ksia1

PDB Entry: 1ksi (more details), 2.2 Å

PDB Description: crystal structure of a eukaryotic (pea seedling) copper-containing amine oxidase at 2.2a resolution
PDB Compounds: (A:) copper amine oxidase

SCOPe Domain Sequences for d1ksia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ksia1 b.30.2.1 (A:207-647) Copper amine oxidase, domain 3 {Pea (Pisum sativum) [TaxId: 3888]}
vskqsppfgpkqhsltshqpqgpgfqinghsvswanwkfhigfdvragivislasiydle
khksrrvlykgyiselfvpyqdpteefyfktffdsgefgfglstvslipnrdcpphaqfi
dtyvhsangtpillknaicvfeqygnimwrhtengipnesieesrtevnlivrtivtvgn
ydnvidwefkasgsikpsialsgileikgtnikhkdeikedlhgklvsansigiyhdhfy
iyyldfdidgthnsfektslktvrikdgsskrksywttetqtaktesdakitiglapael
vvvnpniktavgnevgyrlipaipahpllteddypqirgaftnynvwvtaynrtekwagg
lyvdhsrgddtlavwtkqnreivnkdivmwhvvgihhvpaqedfpimpllstsfelrptn
ffernpvlktlsprdvawpgc

SCOPe Domain Coordinates for d1ksia1 are not available.

Timeline for d1ksia1:

Domains from same chain:
(mouse over for more information)
d1ksia2, d1ksia3
Domains from other chains:
(mouse over for more information)
d1ksib1, d1ksib2, d1ksib3