Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.0: automated matches [227300] (1 protein) not a true family |
Protein automated matches [227126] (20 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255615] (4 PDB entries) |
Domain d2w93d1: 2w93 D:2-181 [244060] Other proteins in same PDB: d2w93a2, d2w93b2, d2w93c2, d2w93d2 automated match to d1qpba2 complexed with mg, py0, tpp |
PDB Entry: 2w93 (more details), 1.6 Å
SCOPe Domain Sequences for d2w93d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w93d1 c.36.1.0 (D:2-181) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} seitlgkylferlkqvnvntvfglpgdfnlslldkiyevegmrwagnanelnaayaadgy arikgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsissqakqlllhhtlgngd ftvfhrmsanisettamitdiatapaeidrcirttyvtqrpvylglpanlvdlnvpakll
Timeline for d2w93d1: