Class g: Small proteins [56992] (91 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) |
Family g.3.11.0: automated matches [227227] (1 protein) not a true family |
Protein automated matches [226968] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225423] (21 PDB entries) |
Domain d2w2ne_: 2w2n E: [244016] Other proteins in same PDB: d2w2na_ automated match to d3bpse1 complexed with ca; mutant |
PDB Entry: 2w2n (more details), 2.3 Å
SCOPe Domain Sequences for d2w2ne_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w2ne_ g.3.11.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]} nlyfqgamgtnecldnnggcsyvcndlkigyeclcpdgfqlvaqrrced
Timeline for d2w2ne_: