Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) |
Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
Protein automated matches [254633] (19 species) not a true protein |
Species Amycolatopsis orientalis [TaxId:31958] [255630] (4 PDB entries) |
Domain d2vzvb5: 2vzv B:778-899 [244005] Other proteins in same PDB: d2vzva1, d2vzva3, d2vzvb1, d2vzvb3 automated match to d2vzsa2 |
PDB Entry: 2vzv (more details), 2.7 Å
SCOPe Domain Sequences for d2vzvb5:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vzvb5 b.1.4.0 (B:778-899) automated matches {Amycolatopsis orientalis [TaxId: 31958]} gsdwyytpqsafadlsglnnlgqsavgatansvagadgtttttvtlkntsggrlpafyvd skvvdsagkpvlpvewndnavslwpgetttltakyrtadlkgskpsvrisgwntgtqtvp ad
Timeline for d2vzvb5: