Lineage for d1qafa1 (1qaf A:301-725)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2052444Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2052445Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) (S)
    automatically mapped to Pfam PF01179
  5. 2052446Family b.30.2.1: Amine oxidase catalytic domain [49999] (2 proteins)
  6. 2052447Protein Copper amine oxidase, domain 3 [50000] (4 species)
  7. 2052513Species Escherichia coli [TaxId:562] [50001] (16 PDB entries)
  8. 2052526Domain d1qafa1: 1qaf A:301-725 [24400]
    Other proteins in same PDB: d1qafa2, d1qafa3, d1qafa4, d1qafb2, d1qafb3, d1qafb4
    complexed with ca, cu, gol; mutant

Details for d1qafa1

PDB Entry: 1qaf (more details), 2.2 Å

PDB Description: the active site base controls cofactor reactivity in escherichia coli amine oxidase : x-ray crystallographic studies with mutational variants
PDB Compounds: (A:) protein (copper amine oxidase)

SCOPe Domain Sequences for d1qafa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qafa1 b.30.2.1 (A:301-725) Copper amine oxidase, domain 3 {Escherichia coli [TaxId: 562]}
pavkpmqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyeg
slggmivpygdpdigwyfkaylesgdygmgtltspiargkdapsnavllnetiadytgvp
meipraiavferyagpeykhqemgqpnvsterrelvvrwistvgnydyifdwifhengti
gidagatgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgen
nslvamdpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnp
vsyqiipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsth
dtglgqyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptl
galkk

SCOPe Domain Coordinates for d1qafa1:

Click to download the PDB-style file with coordinates for d1qafa1.
(The format of our PDB-style files is described here.)

Timeline for d1qafa1: