Lineage for d2vztb5 (2vzt B:778-899)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1768157Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 1768616Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 1768617Protein automated matches [254633] (7 species)
    not a true protein
  7. 1768618Species Amycolatopsis orientalis [TaxId:31958] [255630] (4 PDB entries)
  8. 1768630Domain d2vztb5: 2vzt B:778-899 [243985]
    Other proteins in same PDB: d2vzta1, d2vzta3, d2vztb1, d2vztb3
    automated match to d2vzsa2
    complexed with act, cd, pnj

Details for d2vztb5

PDB Entry: 2vzt (more details), 2.2 Å

PDB Description: complex of amycolatopsis orientalis exo-chitosanase csxa e541a with pnp-beta-d-glucosamine
PDB Compounds: (B:) exo-beta-d-glucosaminidase

SCOPe Domain Sequences for d2vztb5:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vztb5 b.1.4.0 (B:778-899) automated matches {Amycolatopsis orientalis [TaxId: 31958]}
gsdwyytpqsafadlsglnnlgqsavgatansvagadgtttttvtlkntsggrlpafyvd
skvvdsagkpvlpvewndnavslwpgetttltakyrtadlkgskpsvrisgwntgtqtvp
ad

SCOPe Domain Coordinates for d2vztb5:

Click to download the PDB-style file with coordinates for d2vztb5.
(The format of our PDB-style files is described here.)

Timeline for d2vztb5: